- FAM113B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91879
- FAM113B
- Rabbit
- FAM113B
- Human
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: LVWNTAMPVG EEVTGGFLPP KLRRQKATFL KNEVVKANFH SATEARKHNF DVLD
- PC-esterase domain containing 1B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
Specifications/Features
Available conjugates: Unconjugated